Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric oxide synthase mutant (eNOS Y477A)
LigandBDBM130385
Substrate/Competitorn/a
Meas. Tech.Spectral Binding Assay
pH7.5±n/a
Temperature298.15±n/a K
Kd 1.54e+4± 1.2e+3 nM
Commentsextracted
Citation Li, HJamal, JDelker, SPlaza, CJi, HJing, QHuang, HKang, SSilverman, RBPoulos, TL The mobility of a conserved tyrosine residue controls isoform-dependent enzyme-inhibitor interactions in nitric oxide synthases. Biochemistry53:5272-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric oxide synthase mutant (eNOS Y477A)
Name:Nitric oxide synthase mutant (eNOS Y477A)
Synonyms:n/a
Type:Protein
Mol. Mass.:107246.46
Organism:Bos taurus (bovine)
Description:Bovine endothelial nitric oxide synthase mutant Y477A
Residue:973
Sequence:
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSRAPAPATPHAPDHSPAPNSPT
LTRPPEGPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRCCLGSLVLPRKLQTRPSPGPP
PAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDE
APELFVLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIV
DHHAATVSFMKHLDNEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRAQPD
PWKGSATKGAGITRKKTFKEVANAVKISASLMGTLMAKRVKATILYASETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAKAAFQASCETFCVGEEAKA
AAQDIFSPKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRAT
ILVRLDTAGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPTESVAVEQLEKGSPG
GPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPRLLRLLSTLAEEPSEQQELETLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPNAHPGEVHLTVA
VLAYRTQDGLGPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM130385
NameBDBM130385
Synonyms:6(3amino2{5[2(6amino4methylpyridin2 yl)ethyl]pyridin3yl}propyl)4methylpyridin2amine (7)
TypeSmall organic molecule
Emp. Form.C22H28N6
Mol. Mass.376.4979
SMILESCc1cc(N)nc(CCc2cncc(c2)C(CN)Cc2cc(C)cc(N)n2)c1 |w:15.16|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a