Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9 (PDE9)
LigandBDBM8526
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH8±n/a
IC50 40±n/a nM
Commentsextracted
Citation Kaizawa, HYamamoto, HKamijo, KSugita, MSeo, RYamamoto, SUkai, A Pyrazoloquinoline compound US Patent US8822448 Publication Date 9/2/2014
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9 (PDE9)
Name:Phosphodiesterase 9 (PDE9)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:61749.01
Organism:Rattus norvegicus (Rat)
Description:Q8QZV1
Residue:534
Sequence:
MGAGSSSYRPKAIYLDIDGRIQKVVFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAVKQVSEREELVQGVLAQVAEQFSRAFKINELKAEVANH
LAMLEKRVELEGLKVVEIEKCKSDIKKMREELAARNNRTNCPCKYSFLDNKKLTPRRDVP
TYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLC
VHDNYRSNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNN
TYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLIL
ATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLL
EEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPIVEETMLR
PLWESREHYEELKQLDDAMKELQKKTENLTSGATENAPEKTRDAKDNEDRSPPN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8526
NameBDBM8526
Synonyms:CHEMBL1809170 | US8822447, 107 | US8822448, 184 | US9771375, Example 184
Typen/a
Emp. Form.C20H21N3S
Mol. Mass.335.466
SMILESCSc1nn(-c2ccc(C)cc2)c2cc(ccc12)C1=CCNCC1 |t:21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a