Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9A
LigandBDBM131012
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 3±n/a nM
Citation Okada, MSato, SKawade, KGotanda, KShinbo, ANakano, YKobayashi, H Substituted imidazo[1,5-A]quinoxalines as phosphodiesterase 9 inhibitors US Patent US8829000 Publication Date 9/9/2014
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9A
Name:Phosphodiesterase 9A
Synonyms:High affinity cGMP-specific 3'',5''-cyclic phosphodiesterase 9A | Phosphodiesterase 9A (PDE9) | Phosphodiesterase 9A (PDE9A)
Type:Protein
Mol. Mass.:68488.40
Organism:Homo sapiens (human)
Description:O76083
Residue:593
Sequence:
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM131012
n/a
NameBDBM131012
Synonyms:US8829000, 180
TypeSmall organic molecule
Emp. Form.C13H10BrN3O3
Mol. Mass.336.141
SMILESOC(=O)CCc1ncc2n1c1ccc(Br)cc1[nH]c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: