Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B (5HT1B)
LigandBDBM136315
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.4±n/a
Ki 19±n/a nM
Commentsextracted
Citation Andersson, JGyback, HJohansson, ALinde, CEMalmstrom, JNordvall, GWeigelt, TTerp, G 2-carboxamide-7-piperazinyl-benzofuran derivatives US Patent US8859534 Publication Date 10/14/2014
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1B (5HT1B)
Name:5-hydroxytryptamine receptor 1B (5HT1B)
Synonyms:5-HT1B
Type:Protein
Mol. Mass.:42909.60
Organism:Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Description:P46636
Residue:386
Sequence:
MEEQGIQCAPPPPAASQTGVPLVNLSHNCSAESHIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPVSTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVEYAAKRTPKRAAIMIALVWVFSISISLPP
FFWRQAKAEEEVLTCLVNTDHVLYTVYSTGGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTTSVTSINSRAPDLPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMATLDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM136315
NameBDBM136315
Synonyms:US8859534, 1
TypeSmall organic molecule
Emp. Form.C26H27N5O2
Mol. Mass.441.5249
SMILESO=C(NCc1ccccn1)c1cc2cccc(N3CCN(CCc4ccccn4)CC3)c2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a