Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptidyl-prolyl cis-trans isomerase A
LigandBDBM285706
Substrate/Competitorn/a
Meas. Tech.Protease-Free PPIase Assay
pH7.8±n/a
Ki 1.50±n/a nM
Commentsextracted
Citation Pettit, SNJones, ADFrydrych, CSThomas, AJGarst, ME Cyclosporins modified on the MeBmt sidechain by heterocyclic rings US Patent US10077289 Publication Date 9/18/2018
More Info.:Get all data from this article,  Assay Method
 
Peptidyl-prolyl cis-trans isomerase A
Name:Peptidyl-prolyl cis-trans isomerase A
Synonyms:CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIase A | Rotamase A
Type:Protein
Mol. Mass.:18015.32
Organism:Homo sapiens (Human)
Description:P62937
Residue:165
Sequence:
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM285706
NameBDBM285706
Synonyms:US10077289, Compound 14 | [(2S,3R,4R)-7-(5-Fluoro-pyridin-2-yl)-3-hydroxy-4-methyl-2-(methylamino)-heptanoic acid]1 [(R)-methyl-Sar]3 cyclosporin A
TypeSmall organic molecule
Emp. Form.C67H115FN12O12
Mol. Mass.1299.7016
SMILESCC[C@H]1NC(=O)[C@@H]([C@H](O)[C@H](C)CCCc2ccc(F)cn2)N(C)C(=O)[C@@H](C(C)C)N(C)C(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](CC(C)C)N(C)C(=O)[C@H](C)NC(=O)[C@@H](C)NC(=O)[C@@H](CC(C)C)N(C)C(=O)[C@H](NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)N(C)C1=O)C(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a