Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1 (S1P1)
LigandBDBM139204
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
Ki 5±n/a nM
Citation Montagne, CQuattropani, ASauer, WBombrun, A Oxadiazole diaryl compounds US Patent US8889668 Publication Date 11/18/2014
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1 (S1P1)
Name:Sphingosine 1-phosphate receptor 1 (S1P1)
Synonyms:Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM139204
NameBDBM139204
Synonyms:US8889668, I34
TypeSmall organic molecule
Emp. Form.C22H19F6N3O2
Mol. Mass.471.3956
SMILESCC1CCCCN1c1ccc(cc1C(F)(F)F)-c1nc(no1)-c1ccccc1OC(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a