Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP70S6K (T412E)
LigandBDBM224436
Substrate/Competitorn/a
Meas. Tech.P70S6K Enzyme Assay
pH7.5±n/a
IC50>1000±n/a nM
Commentsextracted
Citation Lan, RHuck, BRChen, XDeselm, LCQiu, HXiao, YNeagu, CMochalkin, IJohnson, TL Aminopyrimidine derivatives for use as modulators of kinase activity US Patent US10080750 Publication Date 9/25/2018  Article
More Info.:Get all data from this article,  Assay Method
 
P70S6K (T412E)
Name:P70S6K (T412E)
Synonyms:p70 ribosomal S6 kinase alpha (P70S6K)(T412E)
Type:Enzyme Catalytic Domain
Mol. Mass.:59166.89
Organism:Homo sapiens (Human)
Description:n/a
Residue:525
Sequence:
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFEYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM224436
NameBDBM224436
Synonyms:US10080750, Compound 113 | US9321760, 113 | US9662330, Compound 113
TypeSmall organic molecule
Emp. Form.C27H32ClFN6
Mol. Mass.495.035
SMILESNc1ncnc(N2CCN(CC2)C(CCCN2CCC2)c2ccc(Cl)cc2)c1-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a