Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclophilin D (CypD)
LigandBDBM140002
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
pH7.8±n/a
Temperature293.15±n/a K
IC50 1400±n/a nM
Commentsextracted
Citation Guichou, JColliandre, LAhmed-Belkacem, HPawlotsky, J Inhibitors of cyclophilins and uses thereof US Patent US8901295 Publication Date 12/2/2014
More Info.:Get all data from this article,  Assay Method
 
Cyclophilin D (CypD)
Name:Peptidyl-prolyl cis-trans isomerase D
Synonyms:40 kDa peptidyl-prolyl cis-trans isomerase | CYP-40 | Cyclophilin-40 | Cyclophilin-related protein | PPIase D | Peptidyl-prolyl cis-trans isomerase D | Rotamase D
Type:Protein
Mol. Mass.:40766.62
Organism:Homo sapiens (Human)
Description:Q08752
Residue:370
Sequence:
MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGH
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE
CGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWE
MAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
ELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDK
EKAVYAKMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM140002
NameBDBM140002
Synonyms:US8901295, F671
TypeSmall organic molecule
Emp. Form.C24H26N4O2
Mol. Mass.402.4888
SMILESNc1ccc(CNC(=O)NCC(=O)N2CCCC2c2cccc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a