Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 2
LigandBDBM140242
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Temperature277.15±n/a K
Ki 21±n/a nM
IC50 43.3±n/a nM
Commentsextracted
Citation Meyer, MDWang, XGuo, TWei, RGWang, LJ Chemokine receptor antagonists US Patent US8906911 Publication Date 12/9/2014
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 2
Name:C-C chemokine receptor type 2
Synonyms:C-C chemokine receptor type 2 (CCR2) | Chemoattractant Cytokine Receptor 2 (CCR2) | Chemokine Receptor Type 2b (CCR2b) | Monocyte chemotactic protein-1 (MCP-1)
Type:Enzyme
Mol. Mass.:41932.32
Organism:Homo sapiens (Human)
Description:P41597
Residue:374
Sequence:
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM140242
NameBDBM140242
Synonyms:US8906911, 51
TypeSmall organic molecule
Emp. Form.C28H37ClF3N3O3
Mol. Mass.556.06
SMILESCO[C@@H]1COCC[C@@H]1N(C)[C@@H]1C[C@H]2CCC[C@]2(C1)C(=O)N1C[C@@H]2C[C@H]1CN2c1ccc(Cl)c(c1)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a