Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntegrin alpha-5
LigandBDBM141972
Substrate/Competitorn/a
Meas. Tech.Binding Assay
pH9.6±n/a
Temperature277.15±n/a K
IC50>100±n/a nM
Commentsextracted
Citation Zischinsky, GStragies, ROsterkamp, FScharn, DHummel, GKalkhof, HZahn, GVossmeyer, DChristner-Albrecht, CReineke, U Compounds for the inhibition of integrins and use thereof US Patent US8927534 Publication Date 1/6/2015
More Info.:Get all data from this article,  Assay Method
 
Integrin alpha-5
Name:Integrin alpha-5
Synonyms:CD49 antigen-like family member E | CD49e antigen | FNRA | Fibrinogen receptor subunit alpha 5 beta 1 | Fibronectin receptor subunit alpha | ITGA5 | Integrin alpha-5 precursor | Integrin alpha-F | VLA-5
Type:Single-pass type I membrane protein
Mol. Mass.:114523.00
Organism:Homo sapiens (Human)
Description:n/a
Residue:1049
Sequence:
MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFF
GFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRL
LESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLST
DNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ
IAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTY
GYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQ
EVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFG
VDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSI
GFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDK
LSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVF
GEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDY
FAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVV
SFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRS
SASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAV
YKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYIL
YKLGFFKRSLPYGTAMEKAQLKPPATSDA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM141972
NameBDBM141972
Synonyms:US8927534, 11
TypeSmall organic molecule
Emp. Form.C28H32N4O3
Mol. Mass.472.5787
SMILESCc1cc(C)c(C(=O)NC(Cc2ccc(cc2)N2CC(CNc3ccccn3)C2)C(O)=O)c(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a