Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptidylarginine deiminase 4 (PAD4)
LigandBDBM144278
Substrate/Competitorn/a
Meas. Tech.Colorimetric Assay
IC50 3500±n/a nM
Citation Chen, GWang, YLi, PHu, JWang, SWang, Y Therapeutic compositions and methods US Patent US8969333 Publication Date 3/3/2015
More Info.:Get all data from this article,  Assay Method
 
Peptidylarginine deiminase 4 (PAD4)
Name:Peptidylarginine deiminase 4 (PAD4)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:77711.47
Organism:Homo sapiens (Human)
Description:Q6TGC4
Residue:694
Sequence:
MVSVEGRAMSFQSIIHLSLDSPVHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLIDV
ANTVISEKEDATIWWPLSDPTYATVKMTSPSPSVDADKVSVTYYGPNEDAPVGTAVLYLT
GIEVSLEVDIYRNGQVEMSSDKQAKKKWIWGPSGWGAILLVNCNPADVGQQLEDKKTKKV
IFSEEITNLSQMTLNVQGPSCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPD
QHAYTLALLGNHLKETFYVEAIAFPSAEFSGLISYSVSLVEESQDPSIPETVLYKDTVVF
RVAPCVFIPCTQVPLEVYLCRELQLQGFVDTVTKLSEKSNSQVASVYEDPNRLGRWLQDE
MAFCYTQAPHKTTSLILDTPQAADLDEFPMKYSLSPGIGYMIQDTEDHKVASMDSIGNLM
VSPPVKVQGKEYPLGRVLIGSSFYPSAEGRAMSKTLRDFLYAQQVQAPVELYSDWLMTGH
VDEFMCFIPTDDKNEGKKGFLLLLASPSACYKLFREKQKEGYGDALLFDELRADQLLSNG
REAKTIDQLLADESLKKQNEYVEKCIHLNRDILKTELGLVEQDIIEIPQLFCLEKLTNIP
SDQQPKRSFARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLEPLGFKCTF
INDFDCYLTEVGDICACANIRRVPFAFKWWKMVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM144278
NameBDBM144278
Synonyms:US8969333, YW4-15
TypeSmall organic molecule
Emp. Form.C41H54ClN9O5S
Mol. Mass.820.443
SMILESCN(C)c1ccc2cc(ccc2c1)C(=O)N[C@@H](CCCNC(=N)CCl)C(=O)NCc1ccc(NC(=O)CCCNC(=O)CCCCC2SCC3NC(=O)NC23)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a