Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalmodulin-domain protein kinase 1 (CDPK1)
LigandBDBM50446174
Substrate/Competitorn/a
Meas. Tech.Luminescent Kinase Assay
IC50 6.00±n/a nM
Citation Fan, EVan Voorhis, WCZhang, ZHuang, WOjo, KK 5-aminopyrazole-4-carboxamide inhibitors of CDPK1 from T. gondii and C. parvum US Patent US9518026 Publication Date 12/13/2016
More Info.:Get all data from this article,  Assay Method
 
Calmodulin-domain protein kinase 1 (CDPK1)
Name:Calmodulin-domain protein kinase 1 (CDPK1)
Synonyms:Calmodulin-domain protein kinase 1 | Calmodulin-domain protein kinase, putative
Type:Enzyme Catalytic Domain
Mol. Mass.:57248.42
Organism:Toxoplasma gondii
Description:n/a
Residue:507
Sequence:
MGQQESTLGGAAGEPRSRGHAAGTSGGPGDHLHATPGMFVQHSTAIFSDRYKGQRVLGKG
SFGEVILCKDKITGQECAVKVISKRQVKQKTDKESLLREVQLLKQLDHPNIMKLYEFFED
KGYFYLVGEVYTGGELFDEIISRKRFSEVDAARIIRQVLSGITYMHKNKIVHRDLKPENL
LLESKSKDANIRIIDFGLSTHFEASKKMKDKIGTAYYIAPEVLHGTYDEKCDVWSTGVIL
YILLSGCPPFNGANEYDILKKVEKGKYTFELPQWKKVSESAKDLIRKMLTYVPSMRISAR
DALDHEWIQTYTKEQISVDVPSLDNAILNIRQFQGTQKLAQAALLYMGSKLTSQDETKEL
TAIFHKMDKNGDGQLDRAELIEGYKELMRMKGQDASMLDASAVEHEVDQVLDAVDFDKNG
YIEYSEFVTVAMDRKTLLSRERLERAFRMFDSDNSGKISSTELATIFGVSDVDSETWKSV
LSEVDKNNDGEVDFDEFQQMLLKLCGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446174
NameBDBM50446174
Synonyms:CHEMBL3109010 | US9518026, Example 38
TypeSmall organic molecule
Emp. Form.C17H19N5O
Mol. Mass.309.3657
SMILESCC(C)(C)n1nc(c(C(N)=O)c1N)-c1cnc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a