Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylpolyamine amidohydrolase (APAH)
LigandBDBM152729
Substrate/Competitorn/a
Meas. Tech.APAH Fluorimetric Assay
pH8.2±n/a
IC50 1.3e+2± 1e+1 nM
Commentsextracted
Citation Decroos, CChristianson, DW Design, Synthesis, and Evaluation of Polyamine Deacetylase Inhibitors, and High-Resolution Crystal Structures of Their Complexes with Acetylpolyamine Amidohydrolase. Biochemistry54:4692-703 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylpolyamine amidohydrolase (APAH)
Name:Acetylpolyamine amidohydrolase (APAH)
Synonyms:Acetylpolyamine aminohydrolase
Type:Protein
Mol. Mass.:36324.64
Organism:Mycoplana ramosa (Gram-negative bacterium)
Description:n/a
Residue:341
Sequence:
MRVIFSEDHKLRNAKTELYGGELVPPFEAPFRAEWILAAVKEAGFDDVVAPARHGLETVL
KVHDAGYLNFLETAWDRWKAAGYKGEAIATSFPVRRTSPRIPTDIEGQIGYYCNAAETAI
SPGTWEAALSSMASAIDGADLIAAGHKAAFSLCRPPGHHAGIDMFGGYCFINNAAVAAQR
LLDKGAKKIAILDVDFHHGNGTQDIFYERGDVFFASLHGDPAEAFPHFLGYAEETGKGAG
AGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDTFEQDPISFFKLTSPD
YITMGRTIAASGVPLLVVMEGGYGVPEIGLNVANVLKGVAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM152729
NameBDBM152729
Synonyms:6-Amino-N-hydroxypentanamide (5)
TypeSmall organic molecule
Emp. Form.C6H15N2O2
Mol. Mass.147.195
SMILES[NH3+]CCCCCC(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a