Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntestinal fatty acid-binding protein (hIFABP)
LigandBDBM50074922
Substrate/Competitorn/a
Meas. Tech.Fluorophore Displacement Assay
Temperature566.3±0 K
Ki 2.32e+4± 6.2e+3 nM
Citation Patil, RLaguerre, AWielens, JHeadey, SJWilliams, MLHughes, MLMohanty, BPorter, CJScanlon, MJ Characterization of two distinct modes of drug binding to human intestinal fatty acid binding protein. ACS Chem Biol9:2526-34 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Intestinal fatty acid-binding protein (hIFABP)
Name:Intestinal fatty acid-binding protein (hIFABP)
Synonyms:FABPI | Fatty acid binding protein intestinal | Fatty acid-binding protein, intestinal | I-FABP
Type:Protein
Mol. Mass.:15207.56
Organism:Homo sapiens (Human)
Description:n/a
Residue:132
Sequence:
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074922
NameBDBM50074922
Synonyms:(+-)-2-fluoro-alpha-methyl-4-biphenylacetic acid | 2-(2-fluoro-[1,1'-biphenyl-4-yl])propanoic acid | 2-(2-fluorobiphenyl-4-yl)propanoic acid | 2-fluoro-alpha-methyl-(1,1'-biphenyl)-4-acetic acid | 3-fluoro-4-phenylhydratropic acid | Ansaid | CHEMBL563 | FLURBIPROFEN | US9630914, Compound A
TypeSmall organic molecule
Emp. Form.C15H13FO2
Mol. Mass.244.2609
SMILESCC(C(O)=O)c1ccc(c(F)c1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a