Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target15-Lipoxygenase-2 (15-LOX-2)
LigandBDBM50139862
Substrate/Competitorn/a
Meas. Tech.IC50 Assay
pH7.3±n/a
Temperature298.15±n/a K
IC50 7.1e+4± 3.0e+4 nM
Commentsextracted
Citation Mascayano, CEspinosa, VSepúlveda-Boza, SHoobler, EKPerry, SDiaz, GHolman, TR Enzymatic Studies of Isoflavonoids as Selective and Potent Inhibitors of Human Leukocyte 5-Lipo-Oxygenase. Chem Biol Drug Des86:114-21 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
15-Lipoxygenase-2 (15-LOX-2)
Name:15-Lipoxygenase-2 (15-LOX-2)
Synonyms:15-LOX-2 | 15-Lipo-oxygenase type 2 (15-LOX-2) | 15-lipoxygenase 2 | Arachidonate 15-lipoxygenase type II | Arachidonate 15-lipoxygenase, type II | Arachidonate 15-lipoxygenase-2 | Epithelial 15-lipoxygenase-2
Type:Protein
Mol. Mass.:75850.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:676
Sequence:
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
PYTYLDPPLIENSVSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50139862
NameBDBM50139862
Synonyms:3-(4-Hydroxy-phenyl)-chroman-6,7-diol | 4',6,7-trihydroxyisoflavan | CHEMBL8328 | HIR-1
TypeSmall organic molecule
Emp. Form.C15H14O4
Mol. Mass.258.2693
SMILESOc1ccc(cc1)C1COc2cc(O)c(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a