Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase B (Akt1 E49C, C296S, C310S and C344S )
LigandBDBM50237622
Substrate/Competitorn/a
Meas. Tech.KinEASE Assay
IC50 29± 9 nM
Citation Fang, ZSimard, JRPlenker, DNguyen, HDPhan, TWolle, PBaumeister, SRauh, D Discovery of inter-domain stabilizers-a novel assay system for allosteric akt inhibitors. ACS Chem Biol10:279-88 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase B (Akt1 E49C, C296S, C310S and C344S )
Name:Protein kinase B (Akt1 E49C, C296S, C310S and C344S )
Synonyms:PKB
Type:Protein
Mol. Mass.:55608.09
Organism:Homo sapiens (Human)
Description:Human Akt1 containing mutations E49C, C296S, C310S and C344S
Residue:480
Sequence:
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRCAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLSKEGI
KDGATMKTFSGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMSGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237622
NameBDBM50237622
Synonyms:4-(4-Chlorobenzyl)-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)piperidin- | 4-(4-chlorobenzyl)-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)piperidin-4-amine | CCT128930 | CHEMBL263664 | US8796293, 17
TypeSmall organic molecule
Emp. Form.C18H20ClN5
Mol. Mass.341.838
SMILESNC1(Cc2ccc(Cl)cc2)CCN(CC1)c1ncnc2[nH]ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a