Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase D (PLD)
LigandBDBM154519
Substrate/Competitorn/a
Meas. Tech.In vitro Exogenous Substrate Assay
pH7.5±n/a
IC50 6.1e+3± 5e+2 nM
Commentsextracted
Citation Scott, SASpencer, CTO'Reilly, MCBrown, KALavieri, RRCho, CHJung, DILarock, RCBrown, HALindsley, CW Discovery of desketoraloxifene analogues as inhibitors of mammalian, Pseudomonas aeruginosa, and NAPE phospholipase D enzymes. ACS Chem Biol10:421-32 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase D (PLD)
Name:Phospholipase D (PLD)
Synonyms:Choline phosphatase 1 | PLD 1 | PLD1 | Phosphatidylcholine-hydrolyzing phospholipase D1 | Phospholipase D1 | Phospholipase D1 (PLD1) | Phospholipase D2 (PLD2) | hPLD1
Type:Protein
Mol. Mass.:124219.92
Organism:Homo sapiens (Human)
Description:Q13393
Residue:1074
Sequence:
MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKS
IDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGL
KPHFKLFHPSSESEQGLTRPHADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCF
RVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM154519
NameBDBM154519
Synonyms:Desketoraloxifene (10)
TypeSmall organic molecule
Emp. Form.C27H27NO3S
Mol. Mass.445.573
SMILESOc1ccc(cc1)-c1sc2cc(O)ccc2c1-c1ccc(OCCN2CCCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a