Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChromobox protein homolog 7 (CBX7)
LigandBDBM154547
Substrate/Competitorn/a
Meas. Tech.AlphaScreen Assay
pH8±0
Temperature1937.05±0 K
IC50>1.00e+5± 0 nM
Citation Perfetti, MTBaughman, BMDickson, BMMu, YCui, GMader, PDong, ANorris, JLRothbart, SBStrahl, BDBrown, PJJanzen, WPArrowsmith, CHMer, GMcBride, KMJames, LIFrye, SV Identification of a fragment-like small molecule ligand for the methyl-lysine binding protein, 53BP1. ACS Chem Biol10:1072-81 (2015) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Chromobox protein homolog 7 (CBX7)
Name:Chromobox protein homolog 7
Synonyms:CBX7 | Chromobox protein homolog 7
Type:Protein
Mol. Mass.:28351.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:251
Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM154547
n/a
NameBDBM154547
Synonyms:3-Bromo-N-(3-(isopropylamino)propyl)benzamide (3)
TypeSmall organic molecule
Emp. Form.C13H19BrN2O
Mol. Mass.299.207
SMILESCC(C)NCCCNC(=O)c1cccc(Br)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: