Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPHD finger protein 1 (PHF1)
LigandBDBM154550
Substrate/Competitorn/a
Meas. Tech.AlphaScreen Assay
pH8±0
Temperature1937.05±0 K
IC50>1.00e+5± 0 nM
Citation Perfetti, MTBaughman, BMDickson, BMMu, YCui, GMader, PDong, ANorris, JLRothbart, SBStrahl, BDBrown, PJJanzen, WPArrowsmith, CHMer, GMcBride, KMJames, LIFrye, SV Identification of a fragment-like small molecule ligand for the methyl-lysine binding protein, 53BP1. ACS Chem Biol10:1072-81 (2015) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
PHD finger protein 1 (PHF1)
Name:PHD finger protein 1 (PHF1)
Synonyms:n/a
Type:Protein
Mol. Mass.:62133.86
Organism:Homo sapiens (Human)
Description:O43189
Residue:567
Sequence:
MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREV
CLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHV
PRAPAPGEGEGTSWVCRQCVFAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGH
LSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGG
PEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGE
RSSRLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTSFPSGQGPGGG
VSRPLGKRRRPEPEPLRRRQKGKVEELGPPSAVRNQPEPQEQRERAHLQRALQASVSPPS
PSPNQSYQGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSGPPDRSPLELHIG
FPTDIPKSAPHSMTASSSSVSSPSPGLPRRSAPPSPLCRSLSPGTGGGVRGGVGYLSRGD
PVRVLARRVRPDGSVQYLVEWGGGGIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM154550
n/a
NameBDBM154550
Synonyms:3-Bromo-N-(3-(pyrrolidin-1-yl)propyl)benzamide (6)
TypeSmall organic molecule
Emp. Form.C14H19BrN2O
Mol. Mass.311.217
SMILESBrc1cccc(c1)C(=O)NCCCN1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: