Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAMP deaminase 2 (rAMPD2)
LigandBDBM154584
Substrate/Competitorn/a
Meas. Tech.AMPD Enzymatic Activity Assay
pH7.4±n/a
IC50 3.0e+2± 0 nM
Commentsextracted
Citation Admyre, TAmrot-Fors, LAndersson, MBauer, MBjursell, MDrmota, THallen, SHartleib-Geschwindner, JLindmark, BLiu, JLöfgren, LRohman, MSelmi, NWallenius, K Inhibition of AMP deaminase activity does not improve glucose control in rodent models of insulin resistance or diabetes. Chem Biol21:1486-96 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AMP deaminase 2 (rAMPD2)
Name:AMP deaminase 2 (rAMPD2)
Synonyms:n/a
Type:Protein
Mol. Mass.:94785.47
Organism:Rattus norvegicus (Rat)
Description:n/a
Residue:824
Sequence:
MASYPGPGKSKAKYPFKKRASLQASAAAPEARSGLGASPLQSARSLPGTAPCLKHFPLDL
RTSMDGKCKEIAEELFSRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEP
DILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRGLWERDVVLEREFQRVIISGEEKCGVPF
TDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQSPDTPVSAD
APVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRRDPDEHCPEVELPYPDLQE
FVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRK
VDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFESMNLTAYDLSVDT
LDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMSDLEESKY
QNAELRLSIYGRSRDEWDKLARWAVNHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEML
ENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNP
PYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLR
KAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKE
PLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTN
VPDIRVGYRYETLCQELALITQAVQSEMLETIPEEVGIVMSPGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM154584
NameBDBM154584
Synonyms:4-[4-({[(1R)-1-(isoquinolin-8-yl)ethyl]amino}methyl)phenyl]-2-methoxybenzoic acid (Compound 4)
TypeSmall organic molecule
Emp. Form.C26H24N2O3
Mol. Mass.412.4804
SMILESCOc1cc(ccc1C(O)=O)-c1ccc(CN[C@H](C)c2cccc3ccncc23)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a