Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase subunit beta-1
LigandBDBM36356
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
IC50 1940±n/a nM
Citation Hong, CCHopkins, CRHatzopoulos, AKLindsley, CWHao, J Compounds and methods useful for directing stem cell differentiation US Patent US9040694 Publication Date 5/26/2015
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase subunit beta-1
Name:5'-AMP-activated protein kinase subunit beta-1
Synonyms:5'-AMP-activated protein kinase subunit beta-1 (AMPK) | 5''''''''-AMP-activated protein kinase subunit beta-1 | 5''''-AMP-activated protein kinase catalytic subunit alpha-2/beta-1/gamma-2 | 5''''-AMP-activated protein kinase subunit beta-1 | 5''-AMP-activated protein kinase subunit beta-1 | AMP-activated protein kinase, beta-1 subunit | AMPK | AMPK subunit beta-1 | AMPKb | PRKAB1
Type:n/a
Mol. Mass.:30380.94
Organism:Homo sapiens (Human)
Description:Q9Y478
Residue:270
Sequence:
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36356
NameBDBM36356
Synonyms:DMH3 | N,N-dimethyl-3-(4- (3-(quinolin-4-yl)pyrazolo[1,5-a]pyrimidin-6-yl)phenoxy)propan-1-amine | US9040694, 3
TypeSmall organic molecule
Emp. Form.C26H25N5O
Mol. Mass.423.5096
SMILESCN(C)CCCOc1ccc(cc1)-c1cnc2c(cnn2c1)-c1ccnc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a