Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSUMO-activating enzyme
LigandBDBM43094
Substrate/Competitorn/a
Meas. Tech.Biochemical Assay
IC50 25000±n/a nM
Citation Chen, YLi, YDivlianska, DBobkova, ERoth, GPu, JKhan, P Inhibition of small ubiquitin-like modifier enzymes with substituted pyrrolo[2,3-b]quinoxalines US Patent US9045483 Publication Date 6/2/2015
More Info.:Get all data from this article,  Assay Method
 
SUMO-activating enzyme
Name:SUMO-activating enzyme
Synonyms:SUMO E1
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 977623
Components:This complex has 2 components.
Component 1
Name:SUMO-activating enzyme subunit 2 (SAE2)
Synonyms:6.3.2.- | Anthracycline-associated resistance ARX | SAE2 | SUMO-activating enzyme subunit 2 | UBA2 | UBLE1B | Ubiquitin-like 1-activating enzyme E1B | Ubiquitin-like modifier-activating enzyme 2
Type:Enzyme
Mol. Mass.:71206.17
Organism:Homo sapiens (Human)
Description:Q9UBT2
Residue:640
Sequence:
MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQ
FLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRA
ARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPS
EPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQ
NEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAAN
LRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGK
DVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNN
ADVSEEERSRKRKLDEKENLSAKRSRIEQKEELDDVIALD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:SUMO1 activating enzyme subunit 1
Synonyms:SUMO-activating enzyme subunit 1 (SAE1)
Type:Enzyme Catalytic Domain
Mol. Mass.:38440.84
Organism:Homo sapiens
Description:gi_17390638
Residue:346
Sequence:
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGV
KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE
SFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDY
FLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMA
PVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM43094
NameBDBM43094
Synonyms:2-chloranyl-N-[3-cyano-1-(phenylmethyl)pyrrolo[3,2-b]quinoxalin-2-yl]benzamide | 2-chloro-N-[3-cyano-1-(phenylmethyl)-2-pyrrolo[3,2-b]quinoxalinyl]benzamide | MLS000588660 | N-(1-Benzyl-3-cyano-1H-pyrrolo[2,3-b]quinoxalin-2-yl)-2-chloro-benzamide | N-(1-benzyl-3-cyano-pyrrolo[3,2-b]quinoxalin-2-yl)-2-chloro-benzamide | N-(1-benzyl-3-cyanopyrrolo[3,2-b]quinoxalin-2-yl)-2-chlorobenzamide | SMR000212272 | US9045483, 5 | cid_987585
TypeSmall organic molecule
Emp. Form.C25H16ClN5O
Mol. Mass.437.88
SMILESClc1ccccc1C(=O)Nc1c(C#N)c2nc3ccccc3nc2n1Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a