Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM161623
Substrate/Competitorn/a
Meas. Tech.Fluorescence Polarisation Assay
pH7.4±n/a
IC50 2.6±n/a nM
Commentsextracted
Citation Le Tiran, ALe Diguarher, TStarck, JHenlin, JGuillouzic, ADe Nanteuil, GGeneste, OFejes, ITatai, JNyerges, MDavidson, JEMurray, JBChen, IDurand, D Pyrrole compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9108983 Publication Date 8/18/2015
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM161623
NameBDBM161623
Synonyms:US9108983, Example 440
TypeSmall organic molecule
Emp. Form.C42H43FN6O5
Mol. Mass.730.8264
SMILESCOc1cc(C(=O)N2Cc3ccccc3C[C@H]2CN2CCOCC2)c(cc1F)-c1cc(C(=O)N(c2cc(C#N)n(C)c2C)c2ccc(O)cc2)c(C)n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a