Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 7B
LigandBDBM123687
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.5±n/a
IC50>4000±n/a nM
Commentsextracted
Citation Böss, FErb, CHendrix, MVan Kampen, MWunder, F Selective phosphodiesterase 9A inhibitors as medicaments for improving cognitive processes US Patent US9067945 Publication Date 6/30/2015
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 7B
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 7B
Synonyms:Phosphodiesterase 7B | Phosphodiesterase 7B (PDE7B)
Type:Enzyme
Mol. Mass.:51842.76
Organism:Homo sapiens (Human)
Description:Q9NP56
Residue:450
Sequence:
MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEIS
PLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM123687
NameBDBM123687
Synonyms:US8741907, 3 | US9067945, 2
TypeSmall organic molecule
Emp. Form.C17H26N4O
Mol. Mass.302.4145
SMILESCCC(CC)n1ncc2c1nc(CC1CCCCC1)[nH]c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a