Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 1A (PDE1A)
LigandBDBM168126
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
pH7.5±n/a
Temperature303.15±n/a K
Ki 0.2±n/a nM
Commentsextracted
Citation Li, PZheng, HZhao, JWennogle, LP Organic compounds US Patent US9073936 Publication Date 7/7/2015
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 1A (PDE1A)
Name:Phosphodiesterase 1A (PDE1A)
Synonyms:Calmodulin-dependent phosphodiesterase | Phosphodiesterase 1 | Phosphodiesterase 1B (PDE1B)
Type:Protein
Mol. Mass.:61245.69
Organism:Homo sapiens (Human)
Description:P54750
Residue:535
Sequence:
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM168126
NameBDBM168126
Synonyms:US9073936, 1 | US9598426, 1
TypeSmall organic molecule
Emp. Form.C25H25FN6O2
Mol. Mass.460.5034
SMILESCN1C2=NC(C)(C)CN2c2nn(Cc3ccc(cc3)C(C)=O)c(Nc3ccc(F)cc3)c2C1=O |t:2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a