Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; serotonin & dopamine
LigandBDBM172726
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki 0.91±n/a nM
Citation Bhat, LAdiey, K Methods of using cycloalkylmethylamine derivatives US Patent US9096515 Publication Date 8/4/2015
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; serotonin & dopamine
Name:Monoamine transporters; serotonin & dopamine
Synonyms:DA transporter | DAT | DAT1 | Dopamine transporter (DAT) | Dopamine transporter protein (DAT) | SLC6A3 | Sodium-dependent dopamine transporter (DAT) | Solute carrier family 6 member 3
Type:Multi-pass membrane protein
Mol. Mass.:68497.11
Organism:Homo sapiens (Human)
Description:Q01959
Residue:620
Sequence:
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM172726
NameBDBM172726
Synonyms:US9096515, 33a -(R)-Isomer | US9296681, 33a-(R)-Isomer
TypeSmall organic molecule
Emp. Form.C19H28Cl2N2O
Mol. Mass.371.344
SMILESC[C@@H](CCNCCCC(N)=O)CC1(CCC1)c1ccc(Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a