Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde oxidase (AO)
LigandBDBM175351
Substrate/Competitorn/a
Meas. Tech.AO Enzyme Assay
pH7±n/a
Ki 1.34e+5± 5.62e+4 nM
Commentsextracted
Citation Siah, MFarzaei, MHAshrafi-Kooshk, MRAdibi, HArab, SSRashidi, MRKhodarahmi, R Inhibition of guinea pig aldehyde oxidase activity by different flavonoid compounds: An in vitro study. Bioorg Chem64:74-84 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde oxidase (AO)
Name:Aldehyde oxidase (AO)
Synonyms:Aldehyde: O2 oxidoreductase
Type:Protein
Mol. Mass.:145280.02
Organism:Cavia porcellus (Guinea pig)
Description:H9TB17
Residue:1332
Sequence:
MEPSTLYFYVNGRRVTEKNVDPETMLLPYLGRNLRLTGTKYGCGGGGCGACTVMVSRYDR
GTGQIRHYPACACLTPLCSLHGAAVTTVEGVGSTRTRLHPVQERIAKSHGTQCGFCTPGM
VMSLYALLRSHPQPSEEQLLEALAGNLCRCTGYRPILDAGKTFCKTSGCCQSKENGVCCL
DQGVNGVQEAEGEQTSQELCSEEEFVPLDPTQELIFPPELMILAQKQPQKSRVFTGDRVT
WISPVTLKDLLEAKAKNPRAPVVMGNTSVGPEMKFKGVFHPVIISPDGIEELSVIKQGNE
GLTLGAGLSLAQVQDVLADVVQQLPEEKTQTLCALLKQLRTLAGSQIRNMASLGGHIMSR
HLDSDLNPVLAAASCTLHVPSQEGDRQIPLDEHFLSRSPSADLRPQEVLLSVTIPYSRKW
EFVSAFRQAQRKRSARAIVNVGMRVFFGAGDGVISELCILYGGVGPAIVCATDACRKLVG
RHWTEEMLDEACRLVLGEVAIPGAAPGGRVEFRRTLLVSFLFRFYLQVSQSLSRMDPGRY
PSLVGKYESALEDLCLGHHQRTFELQSADAKQLPQDPIGRPIMHLSGIKHTTGEAIYCDD
MPLVDRELSLAFVTSSRAHAAILSMDLSEALSLPGVVDIVTAEHLGDANSFAKETLLATD
KVLCVGHLVCAVIADSEVQAKRAAEKVKIVYQDLEPLILTIEEAIQHDSFFETERKLESG
DVAEAFRTAEQVLEGSIHMGGQEHFYMETQSMLAVPKGEDQEIDLYVSTQFPTYIQEIVA
STLKLPVNKVMCHVRRVGGAFGGKVGKTAILAAITAFAALKHCRAVRCILERGEDMLITG
GRHPYLGKYKVGFRNNGQVVALDMEHYSNAGSTLDESLMVVEMGLLKMENAYKFPNLRCR
GHACKTNLPSNTALRGFGFPQSGLITEACIVEVAARCGLSPEEVREVNMYRGTEQTHYGQ
EIHTQRLAQCWSECKAKATFSLRRAAVDRFNAGSPWKKRGLAMVPLKFPVGLGSVAMGQA
AALVHVYLDGSVLLTHGGIEMGQGVHTKMIQVVSRELKMPMANVHLRGTSTETVPNANVS
GGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKEWAQAAFDQSISLSAIGYFRGYD
ADMDWEKGKGHPFEYFVYGAACSEVEIDCLTGNHKNIRTDIVMDVGRSINPALDLGQVEG
AFIQGMGLYTSEELKYGPQGALYTRGPDQYKIPAVCDVPAELHVFFLPPSKNSNTLYSSK
GLGESGVFLGCSVLFAIWDAVSAARRERGLPGTLALSCPLTPEKIRMACEDRFTKMIPRD
TPGSYVPWDVVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM175351
NameBDBM175351
Synonyms:3',4',5'-three-Hydroxyl Benzofuranone (3',4',5'-(OH)3) | 6-Hydroxy-2-(3',4',5'-trihydroxybenzylidene)benzofuran-3(2H)-one
TypeSmall organic molecule
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1ccc2C(=O)\C(Oc2c1)=C\c1cc(O)c(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a