Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase D (PLD_SC)
LigandBDBM50345704
Substrate/Competitorn/a
Meas. Tech.pH-Stat Assay
pH8±n/a
IC50 25±0.0 nM
Commentsextracted
Citation Djakpa, HKulkarni, ABarrows-Murphy, SMiller, GZhou, WCho, HTörök, BStieglitz, K Identifying New Drug Targets for Potent Phospholipase D Inhibitors: Combining Sequence Alignment, Molecular Docking, and Enzyme Activity/Binding Assays. Chem Biol Drug Des87:714-29 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase D (PLD_SC)
Name:Phospholipase D (PLD_SC)
Synonyms:n/a
Type:Protein
Mol. Mass.:59647.22
Organism:Streptomyces chromofuscus
Description:Q8KRU5
Residue:556
Sequence:
MTSRYRSSEAHQGLASFSPRRRTVVKAAAATAVLAGPLAAALPARATTGTPAFLHGVASG
DPLPDGVLLWTRVTPTADATPGSGLGPDTEVGWTVATDKAFTNVVAKGSTTATAASDHTV
KADIRGLAPATDHWFRFSAGGTDSPAGRARTAPAADAAVAGLRFGVVSCANWEAGYFAAY
RHLAARGDLDAWLHLGDYIYEYGAGEYGTRGTSVRSHAPAHEILTLADYRVRHGRYKTDP
DLQALHAAAPVVAIWDDHEIANDTWSGGAENHTEGVEGAWAARQAAAKQAYFEWMPVRPA
IAGTTYRRLRFGKLADLSLLDLRSFRAQQVSLGDGDVDDPDRTLTGRAQLDWLKAGLKSS
DTTWRLVGNSVMIAPFAIGSLSAELLKPLAKLLGLPQEGLAVNTDQWDGYTDDRRELLAH
LRSNAIRNTVFLTGDIHMAWANDVPVNAGTYPLSASAATEFVVTSVTSDNLDDLVKVPEG
TVSALASPVIRAANRHVHWVDTDRHGYGVLDITAERAQMDYYVLSDRTQAGATASWSRSY
RTRSGTQRVERTYDPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345704
NameBDBM50345704
Synonyms:1-(tert-butyl)-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3) | 1-tert-butyl-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | 1-tert-butyl-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3) | 1-tert-butyl-3-naphthalen-2-yl-1H-pyrazolo[3,4-d]pyrimidin-4-amine | CHEMBL1231371 | CHEMBL2069957 | US9518026, Example 2 | US9765037, Compound 2
TypeSmall organic molecule
Emp. Form.C19H19N5
Mol. Mass.317.3877
SMILESCC(C)(C)n1nc(-c2ccc3ccccc3c2)c2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a