Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase (SHV-1)
LigandBDBM178204
Substrate/Competitorn/a
Meas. Tech.Cell Free Inhibition Assay
pH7±n/a
Temperature310.15±n/a K
IC50 141.3±n/a nM
Commentsextracted
Citation Bulusu, AR Substituted clavulanic acid US Patent US9120808 Publication Date 9/1/2015
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase (SHV-1)
Name:Beta-lactamase (SHV-1)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:31226.68
Organism:Escherichia coli
Description:P0AD63
Residue:286
Sequence:
MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA
AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG
IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178204
NameBDBM178204
Synonyms:US9120808, Example 37
TypeSmall organic molecule
Emp. Form.C23H25NO8
Mol. Mass.443.4465
SMILESCC(C)(C)C(=O)OCOC(=O)C1N2[C@@H](CC2=O)OC1=C(CC=Cc1ccccc1)C(O)=O |w:18.19,21.22|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a