Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM60825
Substrate/Competitorn/a
Meas. Tech.Time Resolved-Fluorescence Resonance Energy Transfer (TR-FRET) Assay
Ki<0.010±n/a nM
Citation Bruncko, MDing, HDoherty, GAElmore, SWHasvold, LHexamer, LAKunzer, ARMantei, RAMcClellan, WJPark, CHPark, CPetros, AMSong, XSouers, AJSullivan, GMTao, ZWang, GTWang, LWang, XWendt, MD Bcl-2-selective apoptosis-inducing agents for the treatment of cancer and immune diseases US Patent US9125913 Publication Date 9/8/2015
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60825
NameBDBM60825
Synonyms:US9174982, 343
Typen/a
Emp. Form.C47H53Cl2N7O6S
Mol. Mass.914.938
SMILESC[C@]1(O)C[C@@H]2C[C@@H]1CC2CONc1ncc(cc1Cl)S(=O)(=O)NC(=O)c1ccc(cc1Oc1cnc2[nH]ccc2c1)N1CCN(CC2=C(CC(C)(C)CC2)c2ccc(Cl)cc2)CC1 |r,t:52|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a