Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAKT/p21CIP1
LigandBDBM182699
Substrate/Competitorn/a
Meas. Tech.AKT Enzyme Assay
IC50 0.3±n/a nM
Citation Lan, RHuck, BRXiao, YChen, XDeselm, LCQiu, HNeagu, CBankston, DJones, CC Imidazole amines as modulators of kinase activity US Patent US9145392 Publication Date 9/29/2015
More Info.:Get all data from this article,  Assay Method
 
AKT/p21CIP1
Name:AKT/p21CIP1
Synonyms:AKT phosphorylation (p-AKT) | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT)
Type:Enzyme
Mol. Mass.:55681.25
Organism:Homo sapiens (human)
Description:n/a
Residue:480
Sequence:
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM182699
NameBDBM182699
Synonyms:US9145392, 400
TypeSmall organic molecule
Emp. Form.C26H34FN7
Mol. Mass.463.5935
SMILESCCc1c(N)ncnc1N1CCC(CC1)c1nc(cn1CC1CN(C)C1)-c1ccc(F)c(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a