Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1 (S1P1)
LigandBDBM50313357
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 2±n/a nM
Citation Bombrun, ASchwarz, MCrosignani, SCovini, DMarin, D 6-amino-pyrimidine-4-carboxamide derivatives and related compounds which bind to the sphingosine 1-phosphate (S1P) receptor for the treatment of multiple sclerosis US Patent US9150519 Publication Date 10/6/2015
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1 (S1P1)
Name:Sphingosine 1-phosphate receptor 1 (S1P1)
Synonyms:Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50313357
NameBDBM50313357
Synonyms:3-(4-(6-(cyclohexyl(cyclopropylmethyl)amino)pyrimidine-4-carboxamido)-3-methylphenylsulfonamido)propanoic acid | CHEMBL1082869 | US9150519, 1-62
TypeSmall organic molecule
Emp. Form.C25H33N5O5S
Mol. Mass.515.625
SMILESCc1cc(ccc1NC(=O)c1cc(ncn1)N(CC1CC1)C1CCCCC1)S(=O)(=O)NCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a