Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMyristoyl-CoA:protein N-myristoyltransferase (Nmt)
LigandBDBM184966
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 175±n/a nM
Commentsextracted
Citation Brand, SWyatt, PThompson, SSmith, VBayliss, THarrison, JNorcross, NCleghorn, LGilbert, IBrenk, R N-myristoyl transferase inhibitors US Patent US9156811 Publication Date 10/13/2015
More Info.:Get all data from this article,  Assay Method
 
Myristoyl-CoA:protein N-myristoyltransferase (Nmt)
Name:Peptide N-myristoyltransferase
Synonyms:N-myristoyltransferase (NMT1) | Peptide N-myristoyltransferase | Peptide N-myristoyltransferase 1
Type:Enzyme
Mol. Mass.:56814.10
Organism:Homo sapiens (Human)
Description:P30419
Residue:496
Sequence:
MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKK
QKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFW
DTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENY
VEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEK
KMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRS
LNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQF
HLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYN
WKCPSMGAEKVGLVLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM184966
NameBDBM184966
Synonyms:US9156811, DDD88559
TypeSmall organic molecule
Emp. Form.C21H32N4O2S
Mol. Mass.404.569
SMILESCN1CCC(CCCc2ccc(cc2)[S+]([O-])(=O)Nc2c(C)nn(C)c2C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a