Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase (AGAO)
LigandBDBM185658
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.2±n/a
Temperature303.15±n/a K
IC50 7000±n/a nM
Commentsextracted
Citation Sayre, LM Amine oxidase inhibitors US Patent US9161922 Publication Date 10/20/2015
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase (AGAO)
Name:Amine oxidase (AGAO)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:75087.19
Organism:Arthrobacter globiformis
Description:Q59118
Residue:684
Sequence:
MTLQTTPSTPLVQDPPVPATLVHAAAQHPLEQLSAEEIHEARRILAEAGLVGESTRFAYL
GLIEPPKTTRQGDVTGAARLVRAMLWDAAQSRSLDVRLSLATGLVVDRRELNPEADGQLP
VLLEEFGIIEDILSEDPQWNAALTARGLTPAQVRVAPLSAGVFEYGNEEGKRLLRGLGFR
QDHPADHPWAHPIDGLVAFVDVENRRVNHLIDDGPVPVPEVNGNYTDPAIRGELRTDLLP
IEIMQPEGPSFTLEGNHLSWAGWDLRVGFDAREGLVLHQLHHSHKGRRRPVIHRASISEM
VVPYGDPSPYRSWQNYFDSGEYLVGRDANSLRLGCDCLGDITYMSPVVADDFGNPRTIEN
GICIHEEDAGILWKHTDEWAGSDEVRRNRRLVVSFFTTVGNYDYGFYWYLYLDGTIEFEA
KATGIVFTAALPDKDYAYASEIAPGLGAPYHQHLFSARLDMMIDGDANRVEELDLVRLPK
GPGNPHGNAFTQKRTLLARESEAVRDADGAKGRVWHISNPDSLNHLGHPVGYTLYPEGNP
TLAMADDSSIASRAAFARHHLWVTRHAEEELYAAGDFVNQHPGGAVLPAYVAQDRDIDGQ
DLVVWHSFGLTHFPRPEDWPIMPVDTTGFTLKPHGFFDENPTLNVPSSAAGHCGTGSERE
HAAPGGTAVGHSGPDTGGQGHCGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM185658
NameBDBM185658
Synonyms:US9161922, Table 3, Compound 3
TypeSmall organic molecule
Emp. Form.C9H17N3O
Mol. Mass.183.2508
SMILESCCCNC(=O)C(N)CC#CCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a