Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1D (5HT1D)
LigandBDBM186935
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Ki 1121±n/a nM
Commentsextracted
Citation Besnard, JHopkins, ALGilbert, IRuda, GFAbecassis, K Morpholino compounds, uses and methods US Patent US9079895 Publication Date 7/14/2015
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1D (5HT1D)
Name:5-hydroxytryptamine receptor 1D (5HT1D)
Synonyms:Serotonin 1d (5-HT1d) receptor
Type:Enzyme
Mol. Mass.:41605.88
Organism:Mus musculus (Mouse)
Description:Q61224
Residue:374
Sequence:
MSPPNQSLEGLPQEASNRSLNVTGAWDPEVLQALRISLVVVLSVITLATVLSNAFVLTTI
LLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCT
ASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWIISICISIPPLFWRQATAHE
EMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQ
LITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTL
GIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDF
RQAFQKVVHFRKIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM186935
NameBDBM186935
Synonyms:US9079895, 23s
TypeSmall organic molecule
Emp. Form.C21H25ClN2O2
Mol. Mass.372.888
SMILESClc1cccc(OC[C@@H]2CN(CCN3CCc4ccccc34)CCO2)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a