Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM189876
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.4±n/a
Temperature310.15±n/a K
IC50<0.3±n/a nM
Commentsextracted
Citation Von Nussbaum, FKarthaus, DAnlauf, SDelbeck, MLi, VMMeibom, DLustig, KSchamberger, J 4-(4-cyano-2-thioaryl)dihydropyrimidinones and use thereof US Patent US9174997 Publication Date 11/3/2015
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM189876
NameBDBM189876
Synonyms:US9174997, 96
TypeSmall organic molecule
Emp. Form.C26H19F5N6O5S2
Mol. Mass.654.588
SMILESCc1c(cnn1C(F)F)S(=O)(=O)N1[C@@H](C([N+]#[C-])=C(C)N(C1=O)c1cccc(c1)C(F)(F)F)c1ccc(cc1S(C)(=O)=O)C#N |r,t:17|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a