Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 6
LigandBDBM190897
Substrate/Competitorn/a
Meas. Tech.GPR6 In Vitro Assay (A.1)
Temperature310.15±n/a K
IC50 0.0168±n/a nM
Commentsextracted
Citation Brown, JHitchcock, SHopkins, MKikuchi, SMonenschein, HReichard, HSchleicher, KSun, HMacklin, T Substituted pyrido[3,4-b]pyrazines as GPR6 modulators US Patent US9181249 Publication Date 11/10/2015
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled receptor 6
Name:G-protein coupled receptor 6
Synonyms:G-protein coupled receptor 6 (GPR6) | GPR6 | Sphingosine 1-phosphate receptor GPR6
Type:Protein
Mol. Mass.:37886.39
Organism:Homo sapiens (Human)
Description:P46095
Residue:362
Sequence:
MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQL
SAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLL
AGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRR
TLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGI
MLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCV
VGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPS
EV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM190897
NameBDBM190897
Synonyms:US10077266, Example 8 | US9181249, 8 | US9708313, 8
TypeSmall organic molecule
Emp. Form.C25H33F2N5O3
Mol. Mass.489.558
SMILESCOC(C)C(=O)N1CCc2nc(N3CCC(CC3)Oc3ccc(F)cc3F)c(NC(C)C)nc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a