Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Lipoxygenase (5-LOX)
LigandBDBM192701
Substrate/Competitorn/a
Meas. Tech.In-vitro LOX Inhibition Assay
pH9±n/a
Temperature298.15±n/a K
IC50 3.239±0.575 nM
Commentsextracted
Citation Srivastava, PVyas, VKVariya, BPatel, PQureshi, GGhate, M Synthesis, anti-inflammatory, analgesic, 5-lipoxygenase (5-LOX) inhibition activities, and molecular docking study of 7-substituted coumarin derivatives. Bioorg Chem67:130-8 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-Lipoxygenase (5-LOX)
Name:5-Lipoxygenase (5-LOX)
Synonyms:n/a
Type:Protein
Mol. Mass.:97266.07
Organism:Glycine max (Soybean)
Description:n/a
Residue:866
Sequence:
MFSVPGVSGILNRGGGHKIKGTVVLMRKNVLDFNSVADLTKGNVGGLIGTGLNVVGSTLD
NLTAFLGRSVALQLISATKPLANGKGKVGKDTFLEGIIVSLPTLGAGESAFNIQFEWDES
MGIPGAFYIKNYMQVEFYLKSLTLEDVPNQGTIRFVCNSWVYNTKLYKSVRIFFANHTYV
PSETPAALVGYREEELKNLRGDGKGERKEHDRIYDYDVYNDLGNPDHGENFARPILGGSS
THPYPRRGRTGRYPTRKDQNSEKPGEVYVPRDENFGHLKSSDFLAYGIKSLSQYVLPAFE
SVFDLNFTPNEFDSFQDVRDLHEGGIKLPTEVISTIMPLPVVKELFRTDGEQVLKFPPPH
VIQVSKSAWMTDEEFAREMVAGVNPCVIRGLQEFPPKSNLDPTIYGEQTSKITADALDLD
GYTVDEALASRRLFMLDYHDVFMPYIRRINQTYAKAYATRTILFLRENGTLKPVAIELSL
PHPAGDLSGAVSQVILPAKEGVESTIWLLAKAYVVVNDSCYHQLMSHWLNTQAVIEPFII
ATNRHLSALHPIYKLLTPHYRDTMNINALARQSLINADGIIEKSFLPSKHSVEMSSAVYK
NWVFTDQALPADLIKRGVAIKDPSAPHGLRLLIEDYPYAVDGLEIWAAIKTWVQEYVSLY
YARDDDVKPDSELQQWWKEAVEKGHGDLKDKPWWPKLQTIEELVEICTIIIWTASALHAA
VNFGQYPYGGFILNRPTSSRRLLPEKGTPEYEEMVKSHQKAYLRTITSKFQTLVDLSVIE
ILSRHASDEVYLGQRDNPHWTSDSKALQAFQKFGNKLKEIEEKLARKNNDQSLSNRLGPV
QLPYTLLHPNSEEGLTCRGIPNSISI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM192701
NameBDBM192701
Synonyms:7-(2-hydroxy-3-(6-nitrobenzo[d]thiazol-2-ylamino)propoxy)-4-methyl-2H-chromen-2-one (31)
TypeSmall organic molecule
Emp. Form.C20H17N3O6S
Mol. Mass.427.43
SMILESCc1cc(=O)oc2cc(OCC(O)CNc3nc4ccc(cc4s3)[N+]([O-])=O)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a