Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-10 (IL-10)
LigandBDBM192716
Substrate/Competitorn/a
Meas. Tech.AlphaLISA-based IL-10 Detection
EC50 460±n/a nM
Citation Sundberg, TBLiang, YWu, HChoi, HGKim, NDSim, TJohannessen, LPetrone, AKhor, BGraham, DBLatorre, IJPhillips, AJSchreiber, SLPerez, JShamji, AFGray, NSXavier, RJ Development of Chemical Probes for Investigation of Salt-Inducible Kinase Function in Vivo. ACS Chem Biol11:2105-11 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-10 (IL-10)
Name:Interleukin-10 (IL-10)
Synonyms:n/a
Type:Protein
Mol. Mass.:20520.59
Organism:Homo sapiens (Human)
Description:n/a
Residue:178
Sequence:
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM192716
NameBDBM192716
Synonyms:YKL-05-099 (5)
TypeSmall organic molecule
Emp. Form.C32H34ClN7O3
Mol. Mass.600.11
SMILESCOc1ccc(nc1)N1C(=O)N(Cc2cnc(Nc3ccc(cc3OC)C3CCN(C)CC3)nc12)c1c(C)cccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a