Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4/SDF-1)
LigandBDBM194519
Substrate/Competitorn/a
Meas. Tech.Competitive Binding Assay
IC50 10±n/a nM
Citation Natchus, MGArrendale, RLiotta, D Tricyclic amino containing compounds for treatment or prevention of symptoms associated with endocrine dysfunction US Patent US9205085 Publication Date 12/8/2015
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4/SDF-1)
Name:C-X-C chemokine receptor type 4 (CXCR4/SDF-1)
Synonyms:C-X-C chemokine receptor type 4
Type:Enzyme
Mol. Mass.:39342.13
Organism:Rattus norvegicus (Rat)
Description:O08565
Residue:349
Sequence:
MEIYTSDNYSEEVGSGDYDSNKEPCFRDENENFNRIFLPTIYFIIFLTGIVGNGLVILVM
GYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSS
VLILAFISLDRYLAIVHATNSQSARKLLAEKAVYVGVWIPALLLTIPDIIFADVSQGDGR
YICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVI
LILAFFACWLPYYVGISIDSFILLEVIKQGCEFESVVHKWISITEALAFFHCCLNPILYA
FLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM194519
NameBDBM194519
Synonyms:US9205085, MSX- 195
TypeSmall organic molecule
Emp. Form.C18H18N4
Mol. Mass.290.3623
SMILESC(Nc1ccccc1)c1ccc(CNc2ncccn2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a