Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAndrogen-dependent TFPI-regulating protein (ADTRP)
LigandBDBM195604
Substrate/Competitorn/a
Meas. Tech.Gel-based ABPP Assay
IC50 8.5e+3± 3.0e+3 nM
Citation Parsons, WHKolar, MJKamat, SSCognetta, ABHulce, JJSaez, EKahn, BBSaghatelian, ACravatt, BF AIG1 and ADTRP are atypical integral membrane hydrolases that degrade bioactive FAHFAs. Nat Chem Biol12:367-72 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Androgen-dependent TFPI-regulating protein (ADTRP)
Name:Androgen-dependent TFPI-regulating protein (ADTRP)
Synonyms:n/a
Type:Protein
Mol. Mass.:26858.19
Organism:Homo sapiens (Human)
Description:n/a
Residue:230
Sequence:
MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGV
TCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDT
VIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTW
VYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM195604
NameBDBM195604
Synonyms:JJH260
TypeSmall organic molecule
Emp. Form.C29H34ClN5O5
Mol. Mass.568.064
SMILESCN(C)c1ccc(cc1)C(=O)N1CCN2C(C1)C(=O)N(OC(=O)N1CCC(CCc3ccc(Cl)cc3)CC1)C2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a