Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4C (KDM4C)
LigandBDBM195610
Substrate/Competitorn/a
Meas. Tech.KDM4C Enzymatic Screening Assay
pH7.5±n/a
IC50 6.2e+2± 0 nM
Commentsextracted
Citation Vinogradova, MGehling, VSGustafson, AArora, STindell, CAWilson, CWilliamson, KEGuler, GDGangurde, PManieri, WBusby, JFlynn, EMLan, FKim, HJOdate, SCochran, AGLiu, YWongchenko, MYang, YCheung, TKMaile, TMLau, TCosta, MHegde, GVJackson, EPitti, RArnott, DBailey, CBellon, SCummings, RTAlbrecht, BKHarmange, JCKiefer, JRTrojer, PClasson, M An inhibitor of KDM5 demethylases reduces survival of drug-tolerant cancer cells. Nat Chem Biol12:531-8 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4C (KDM4C)
Name:Lysine-specific demethylase 4C (KDM4C)
Synonyms:n/a
Type:Protein
Mol. Mass.:40626.08
Organism:Homo sapiens (Human)
Description:Q9H3R0; His-tagged recombinant KDM4C (1-350) overexpressed in E. coli(DE3)
Residue:350
Sequence:
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM195610
NameBDBM195610
Synonyms:KDM inhibitor, 3
TypeSmall organic molecule
Emp. Form.C10H10N4O
Mol. Mass.202.2126
SMILESCCc1c(C)[nH]c2c(cnn2c1=O)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a