Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLactate dehydrogenase A (LDHA)
LigandBDBM197159
Substrate/Competitorn/a
Meas. Tech.LHDA/LDHB Enzymatic Assays
IC50 1.2e+2± 0 nM
Citation Boudreau, APurkey, HEHitz, ARobarge, KPeterson, DLabadie, SKwong, MHong, RGao, MDel Nagro, CPusapati, RMa, SSalphati, LPang, JZhou, ALai, TLi, YChen, ZWei, BYen, ISideris, SMcCleland, MFirestein, RCorson, LVanderbilt, AWilliams, SDaemen, ABelvin, MEigenbrot, CJackson, PKMalek, SHatzivassiliou, GSampath, DEvangelista, MO'Brien, T Metabolic plasticity underpins innate and acquired resistance to LDHA inhibition. Nat Chem Biol12:779-86 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lactate dehydrogenase A (LDHA)
Name:L-lactate dehydrogenase A chain
Synonyms:Cell proliferation-inducing gene 19 protein | L-lactate dehydrogenase A | L-lactate dehydrogenase A Chain | LDH muscle subunit | LDH-A | LDH-M | Renal carcinoma antigen NY-REN-59
Type:Protein
Mol. Mass.:36694.85
Organism:Homo sapiens (Human)
Description:P00338::PDB Code: 4ajp
Residue:332
Sequence:
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM197159
NameBDBM197159
Synonyms:3-((2-chlorophenyl)thio)-4-hydroxy-6-phenyl-6-(thiophen-3-yl)-5,6-dihydropyridin-2(1H)-one (5)
TypeSmall organic molecule
Emp. Form.C21H16ClNO2S2
Mol. Mass.413.94
SMILESOC1=C(Sc2ccccc2Cl)C(=O)NC(C1)(c1ccsc1)c1ccccc1 |w:14.17,14.23,c:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a