Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase JAK2 [828-1132]
LigandBDBM197717
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
pH7.8±n/a
Temperature298.15±n/a K
IC50 0.65±0 nM
Commentsextracted
Citation Li, YRodgers, JD 3-[4-(7H-pyrrolo[2,3-D]pyrimidin-4-yl)-1H-pyrazol-1-yl]octane—or heptane-nitrile as JAK inhibitors US Patent US9216984 Publication Date 12/22/2015
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase JAK2 [828-1132]
Name:Tyrosine-protein kinase JAK2 [828-1132]
Synonyms:JAK2 (aa 828-1132) | Tyrosine-protein kinase JAK2
Type:n/a
Mol. Mass.:35579.28
Organism:Homo sapiens (Human)
Description:O60674[828-1132]
Residue:305
Sequence:
GALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHS
TEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKER
IDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEY
YKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGN
DKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIR
DNMAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM197717
NameBDBM197717
Synonyms:US9216984, 2
TypeSmall organic molecule
Emp. Form.C16H18N6
Mol. Mass.294.3543
SMILESCCCCC(CC#N)n1cc(cn1)-c1ncnc2[nH]ccc12
Structure
n/a