Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM86761
Substrate/Competitorn/a
Meas. Tech.A1 Adenosine Receptor Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 14±4 nM
Commentsextracted
Citation Cosimelli, BGreco, GLaneri, SNovellino, ESacchi, ATrincavelli, MLGiacomelli, CTaliani, SDa Settimo, FMartini, C 4-amino-6-alkyloxy-2-alkylthiopyrimidine derivatives as novel non-nucleoside agonists for the adenosine A1 receptor. Chem Biol Drug Des88:724-729 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (Human)
Description:P30542
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86761
NameBDBM86761
Synonyms:CAS_35920-39-9 | NECA | NSC_448222
TypeSmall organic molecule
Emp. Form.C12H16N6O4
Mol. Mass.308.2932
SMILESCCNC(=O)C1OC(C(O)C1O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a