Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetComplement factor B
LigandBDBM160500
Substrate/Competitorn/a
Meas. Tech.Human Complement Factor B TR-FRET Assay
IC50 0.02±n/a nM
Citation Adams, CMCapparelli, MPEhara, TKarki, RGMainolfi, NZhang, C Piperidinyl-indole derivatives complement factor B inhibitors and uses thereof US Patent US9682968 Publication Date 6/20/2017
More Info.:Get all data from this article,  Assay Method
 
Complement factor B
Name:Complement factor B
Synonyms:n/a
Type:Enzyme
Mol. Mass.:85537.97
Organism:Homo sapiens (Human)
Description:P00751
Residue:764
Sequence:
MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQ
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQ
AVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM160500
NameBDBM160500
Synonyms:US10093663, Example 37 | US9682968, Example-37
TypeSmall organic molecule
Emp. Form.C26H33N3O5S
Mol. Mass.499.622
SMILESCCO[C@H]1CCN(Cc2c(OC)cc(C)c3[nH]ccc23)[C@@H](C1)c1ccc(cc1)C(=O)NS(C)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a