Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-2 (MMP-2)
LigandBDBM199122
Substrate/Competitorn/a
Meas. Tech.enzyme-based fluorimetric assay
IC50 123.4±0.36 nM
Citation Zheng, XZZhou, JLYe, JGuo, PPLin, CS Cardioprotective effect of novel sulphonamides-1,3,5-triazine conjugates against ischaemic-reperfusion injury via selective inhibition of MMP-9. Chem Biol Drug Des88:756-765 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-2 (MMP-2)
Name:Matrix metalloproteinase-2 (MMP-2)
Synonyms:72 kDa type IV collagenase
Type:n/a
Mol. Mass.:74137.51
Organism:Rattus norvegicus (Rat)
Description:P33436
Residue:662
Sequence:
MEARLVWGVLVGPLRVLCVLCCLLGHAIAAPSPIIKFPGDVSPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKM
DPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
GC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM199122
n/a
NameBDBM199122
Synonyms:N-(4-(1-(4,6-bis(phenylamino)-1,3,5-triazin-2-yl)-5-(4-methoxyphenyl)-1H-pyrazol-3-yl)phenyl)-4-methylbenzenesulphonamide (8d)
TypeSmall organic molecule
Emp. Form.C38H32N8O3S
Mol. Mass.680.777
SMILESCOc1ccc(cc1)-c1cc(nn1-c1nc(Nc2ccccc2)nc(Nc2ccccc2)n1)-c1ccc(NS(=O)(=O)c2ccc(C)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: