Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (Y1660L) (ARTD8 or PARP14(Y1660L))
LigandBDBM199181
Substrate/Competitorn/a
Meas. Tech.Enzymatic Activity Assay
IC50 1.63e+3± 0 nM
Citation Venkannagari, HVerheugd, PKoivunen, JHaikarainen, TObaji, EAshok, YNarwal, MPihlajaniemi, TLüscher, BLehtiö, L Small-Molecule Chemical Probe Rescues Cells from Mono-ADP-Ribosyltransferase ARTD10/PARP10-Induced Apoptosis and Sensitizes Cancer Cells to DNA Damage. Cell Chem Biol23:1251-1260 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (Y1660L) (ARTD8 or PARP14(Y1660L))
Name:Human diphtheria toxin-like ADP-ribosyltransferase (Y1660L) (ARTD8 or PARP14(Y1660L))
Synonyms:n/a
Type:n/a
Mol. Mass.:30789.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:267
Sequence:
IEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLS
VQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNP
DLWNSLQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTY
FAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVT
DNVHHPSLFVAFYDYQAYPEYLITFRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM199181
NameBDBM199181
Synonyms:4-[(4-Carbamoylcyclohexyl)oxy]cyclohexane-1-carboxamide (OUL35)
TypeSmall organic molecule
Emp. Form.C14H12N2O3
Mol. Mass.256.2567
SMILESNC(=O)c1ccc(Oc2ccc(cc2)C(N)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a