BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCystic fibrosis transmembrane conductance regulator
LigandBDBM200234
Substrate/Competitorn/a
IC50>50000±n/a nM
Citation PubChem, PC Phenotypic Assay to Identify Small Molecules that Upregulate Production of hCFTR in HeLa Cells PubChem Bioassay(2016)[AID]
More Info.:Get all data from this article
 
Cystic fibrosis transmembrane conductance regulator
Name:Cystic fibrosis transmembrane conductance regulator
Synonyms:ABCC7 | ATP-binding cassette sub-family C member 7 | CFTR | Channel conductance-controlling ATPase | cAMP-dependent chloride channel
Type:Enzyme Catalytic Domain
Mol. Mass.:168171.30
Organism:Homo sapiens (Human)
Description:gi_90421313
Residue:1480
Sequence:
MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRE
LASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIA
IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQL
VSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGL
GRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAA
YVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQT
WYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRK
TSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEG
KIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV
LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR
ILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNS
ILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQ
MNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQG
QNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESI
PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRN
NSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAP
MSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATV
PVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHK
ALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIM
STLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKK
DDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRL
LNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVAD
EVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVT
YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQA
ISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM200234
NameBDBM200234
Synonyms:AB00053570_02 | cid_4068
TypeSmall organic molecule
Emp. Form.C20H9Br2HgO6
Mol. Mass.705.68
SMILESO.[O-]C(=O)c1ccccc1-c1c2cc(Br)c(=O)cc2oc2c([Hg])c([O-])c(Br)cc12 |(12.53,-4.56,;5.85,5.52,;5.85,3.98,;4.52,3.21,;7.18,3.21,;7.18,4.75,;8.52,5.52,;9.85,4.75,;9.85,3.21,;8.52,2.44,;8.52,.9,;7.18,.13,;5.81,.95,;4.41,.16,;3.08,.93,;4.41,-1.45,;3.08,-2.22,;5.81,-2.24,;7.18,-1.41,;8.52,-2.18,;9.85,-1.41,;11.23,-2.24,;11.21,-3.78,;12.62,-1.45,;13.95,-2.22,;12.62,.16,;13.95,.93,;11.23,.95,;9.85,.13,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a