Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetComplement factor B
LigandBDBM159840
Substrate/Competitorn/a
Meas. Tech.Human Complement Factor B TR-FRET Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 840±n/a nM
Commentsextracted
Citation Adams, CMCapparelli, MPEhara, TKarki, RGMainolfi, NZhang, C Piperidinyl-indole derivatives complement factor B inhibitors and uses thereof US Patent US10093663 Publication Date 10/9/2018
More Info.:Get all data from this article,  Assay Method
 
Complement factor B
Name:Complement factor B
Synonyms:n/a
Type:Enzyme
Mol. Mass.:85537.97
Organism:Homo sapiens (Human)
Description:P00751
Residue:764
Sequence:
MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQ
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQ
AVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM159840
NameBDBM159840
Synonyms:US10093663, Example 17-21 | US9682968, Example-17-21
TypeSmall organic molecule
Emp. Form.C23H26N2O2
Mol. Mass.362.4647
SMILESCc1cc(C)c2[nH]ccc2c1CN1CCCCC1c1cccc(c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a